PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00016377-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 71aa    MW: 8365.75 Da    PI: 10.4555
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00016377-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.84.9e-083565232
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmg 32
                         +W++eEd++l+ ++k++G  +W++ ++  g
  WALNUT_00016377-RA 35 ASWSPEEDQKLKAYIKRYGIWNWNRMPEASG 65
                        58*****************99***9888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.3692971IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-93063IPR009057Homeodomain-like
SuperFamilySSF466893.52E-73163IPR009057Homeodomain-like
CDDcd001671.64E-43667No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 71 aa     Download sequence    Send to blast
MVLRSLQVEI SGQYLEMMMM PKTSDGEKMP GRSRASWSPE EDQKLKAYIK RYGIWNWNRM  60
PEASGRKLIS R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18570.19e-09myb domain protein 51